PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC006051.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 308aa    MW: 33915.9 Da    PI: 7.6676
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC006051.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.61.1e-31102158360
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                   +vrY+eCl+NhAas+Gg ++DGCgEfmp+ ge+gta al+CaAC+CHRnFHR+ev+ e
  EcC006051.30 102 SVRYRECLRNHAASVGGSVYDGCGEFMPA-GEDGTAGALRCAACECHRNFHRKEVDGE 158
                   69**************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-22103156IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.9E-29103155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.2E-28104155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.942105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.5E-29232301IPR009057Homeodomain-like
SuperFamilySSF466891.12E-17233300IPR009057Homeodomain-like
TIGRFAMsTIGR015652.4E-28239296IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MELKPQEDDV TAPVSSLGFA HFARDSRRID NGAPVLGAAP QTLDDHPPQQ RPILHPHQPH  60
PDDDVKPERE DSNPDPVSFA FSRSSALPAP AGSKPKPSPS PSVRYRECLR NHAASVGGSV  120
YDGCGEFMPA GEDGTAGALR CAACECHRNF HRKEVDGETL HLSTGFRRGL VPPLQLPPPP  180
LASPYQRYSV GVVHSPMVTP MSVAFGGGGG GNESSSEDLN LFGSDHLHRH AATAPPFSKK  240
RFRTKFTQEQ KDRMMEFAER VGWRIQKQNE EEVERFCGEI GVRRQVLKVW MHNNKNNVKN  300
KQPSDQPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-262382971675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010060955.10.0PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9ZPW74e-62ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A059BP840.0A0A059BP84_EUCGR; Uncharacterized protein
STRINGPOPTR_0002s03660.11e-83(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-56homeobox protein 31